PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010915588.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family TCP
Protein Properties Length: 419aa    MW: 44143.7 Da    PI: 7.7729
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010915588.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP1195.8e-3749138293
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaks 93 
                     +g+kdrhsk++T++g+RdRRvRlsa++a++f+d+qd+LG+d++sk+++WL+++ak+ai+el+++++ ++  c++++ s s+  + s+ ++++
  XP_010915588.1  49 TGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDVQDRLGYDRPSKAVDWLIKNAKAAIDELAELPAWHP--CSTSAASASNPPPASDPQETQ 138
                     79**************************************************************44444..522222222222222212222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.3E-3249123IPR005333Transcription factor, TCP
PROSITE profilePS5136934.08651109IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MAEAHGHGHG LLALHHGHQQ QHQRPRFGGG LSGAGEIVEV QGGHIVRSTG RKDRHSKVCT  60
AKGPRDRRVR LSAHTAIQFY DVQDRLGYDR PSKAVDWLIK NAKAAIDELA ELPAWHPCST  120
SAASASNPPP ASDPQETQAL VAANQPVGDS SKKPIPVAEP VASAAFSFGG GTGGGSGSAS  180
FLPPSLDSDA IADTIKSFFP MGAAAATATA TAPPSSPPIG FQNYPPDLLS RSSSQDLRLS  240
LQSFQDPTFH NPRSSHHHQR HHPQSQHLHQ NPAPSVQQAL FSGSAHLAFD TASAGWSEQS  300
HRMFPWNVAE TGGGGGGYVF HVPPPQAVPP HPVLGQSHFF TQRGPLQSSN SPAIRAWADP  360
IVSATDQQLH PALHPSLSSI GFASGAGFSG FRIPARIQGE EEHDGISNKP PSASSASHH
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00009PBMTransfer from 929286Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010915588.10.0PREDICTED: transcription factor PCF5-like
RefseqXP_010915589.10.0PREDICTED: transcription factor PCF5-like
RefseqXP_010915590.10.0PREDICTED: transcription factor PCF5-like
RefseqXP_010915591.10.0PREDICTED: transcription factor PCF5-like
SwissprotQ8LPR52e-99TCP4_ARATH; Transcription factor TCP4
TrEMBLM0SW951e-146M0SW95_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P06660_0011e-145(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58393355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53230.17e-66TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 3